Review (1)Publications (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of L929 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of H9C2 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using PHGDH Rabbit pAb (A10461) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PHGDH antibody (A10461). Western blot was performed from the immunoprecipitate using PHGDH antibody (A10461) at a dilution of 1:1000.
| Product name | PHGDH Rabbit pAb |
|---|---|
| Catalog No. | A10461 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 264-533 of human PHGDH (NP_006614.2). |
|---|---|
| Sequence | EEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113; PHGDH |
| Calculated MW | 57kDa |
| Observed MW | 57kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, HT-29, MCF7, NIH/3T3, C6, Mouse brain |
| Cellular location | cytosol, extracellular exosome. |
| Customer validation | (PC-3 HEPG2 HELA MOLT4 A549 JURKAT 293T RPMI-8226) WB(Mus musculus, Homo sapiens) Neutralization(Bombyx mori Linnaeus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A10461? Please let us know so that we can cite the reference in this datasheet.
