Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PI3 Kinase p110 delta Rabbit mAb |
---|---|
Catalog No. | A19742 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2268 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI3 Kinase p110 delta (O00329). |
---|---|
Sequence | EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR |
Gene ID | |
Swiss Prot | |
Synonyms | APDS; PI3K; IMD14; p110D; IMD14A; IMD14B; ROCHIS; P110DELTA; PI3 Kinase p110 delta |
Calculated MW | 119kDa |
Observed MW | 119kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse thymus |
Cellular location | cytoplasm, cytosol, plasma membrane |
Customer validation | WB(Rattus norvegicus, Mus musculus, Gallus gallus, Homo sapiens, Oryctolagus cuniculus, Other) IHC(Homo sapiens) IF(Homo sapiens) IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19742? Please let us know so that we can cite the reference in this datasheet.