Reviews (3)Publications (10) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PI3 Kinase p85 alpha Rabbit pAb |
---|---|
Catalog No. | A11177 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human PI3 Kinase p85 alpha (NP_852664.1). |
---|---|
Sequence | LQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL |
Gene ID | |
Swiss Prot | |
Synonyms | p85; AGM7; GRB1; IMD36; p85alpha; p85-ALPHA; PI3 Kinase p85 alpha |
Calculated MW | 84kDa |
Observed MW | 85kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, 293F, NIH/3T3 |
Cellular location | cell-cell junction, cis-Golgi network, cytoplasm, cytosol, nucleus, perinuclear region of cytoplasm, plasma membrane |
Customer validation | (Human chronic myeloid leukemia cells) WB(Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Rattus norvegicus) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11177? Please let us know so that we can cite the reference in this datasheet.