Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PKC alpha Rabbit mAb |
---|---|
Catalog No. | A11107 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0197 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (P17252). |
---|---|
Sequence | MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV |
Gene ID | |
Swiss Prot | |
Synonyms | AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha; PKC alpha |
Calculated MW | 77kDa |
Observed MW | 76kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein. |
Customer validation | WB(Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11107? Please let us know so that we can cite the reference in this datasheet.