제품 > 항체 > 단일클론항체(mAb)

PLCB2 Rabbit mAb (A22526)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from HEL cells, using PLCB2 Rabbit mAb (A22526) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Mouse thymus, using PLCB2 Rabbit mAb (A22526) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PLCB2 Rabbit mAb (A22526)

Immunohistochemistry analysis of paraffin-embedded human colon using PLCB2 Rabbit mAb (A22526) at dilution of1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human spleen using PLCB2 Rabbit mAb (A22526) at dilution of1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	PLCB2 Rabbit mAb
Catalog No.	A22526
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55276

Background

The protein encoded by this gene is a phosphodiesterase that catalyzes the hydrolysis of phosphatidylinositol 4, 5-bisphosphate to the second messengers inositol 1, 4, 5-trisphosphate (IP3) and diacylglycerol. The encoded protein is activated by G proteins and has been shown to be involved in the type 2 taste receptor signal transduction pathway. In addition, nuclear factor kappa B can regulate the transcription of this gene, whose protein product is also an important regulator of platelet responses.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human PLCB2 (NP_004564.2).
Sequence	MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKNDAIN
Gene ID
Swiss Prot
Synonyms	PLC-beta-2; PLCB2
Calculated MW	134kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HEL, Mouse thymus
Cellular location	cytosol, G-protein beta/gamma-subunit complex, Golgi apparatus, neuronal dense core vesicle, plasma membrane
Customer validation	WB(Rattus norvegicus)