제품 > 항체 > 단일클론항체(mAb)

POLR2A (N-terminal) Rabbit mAb (A21980)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse thymus, using POLR2A (N-terminal) Rabbit mAb (A21980) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - POLR2A (N-terminal) Rabbit mAb (A21980)

Immunoprecipitation analysis of 600 μg extracts of 293F cells using 3 μg POLR2A(N-terminal) antibody (A21980). Western blot was performed from the immunoprecipitate using POLR2A(N-terminal) antibody (A21980) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - POLR2A (N-terminal) Rabbit mAb (A21980)

Chromatin immunoprecipitation analysis of extracts of 293F cells, using POLR2A NTD antibody (A21980) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	POLR2A (N-terminal) Rabbit mAb
Catalog No.	A21980
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54153

Background

This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 550-650 of human POLR2A POLR2A (N-terminal) (NP_000928.1).
Sequence	KRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAG
Gene ID
Swiss Prot
Synonyms	RPB1; RPO2; POLR2; POLRA; RPBh1; RPOL2; NEDHIB; RpIILS; hsRPB1; hRPB220; POLR2A (N-terminal)
Calculated MW	217kDa
Observed MW	250kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:12000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Mouse thymus
Cellular location	Nucleus.
Customer validation	ChIP(Homo sapiens)