Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PPP1CA Rabbit pAb |
---|---|
Catalog No. | A12468 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-330 of human PPP1CA (NP_002699.1). |
---|---|
Sequence | EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Gene ID | |
Swiss Prot | |
Synonyms | PP1A; PP-1A; PPP1A; PP1alpha |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | MCF7, HeLa, NIH/3T3, C6 |
Cellular location | Cytoplasm, Nucleus, nucleolus, nucleoplasm |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus, Mus musculus, Homo sapiens, Oryctolagus cuniculus) IF(Rattus norvegicus, Mus musculus, Homo sapiens) IP(Homo sapiens) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12468? Please let us know so that we can cite the reference in this datasheet.