Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pan-Akt Rabbit pAb |
---|---|
Catalog No. | A18120 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 311-480 of human AKT1/AKT2/AKT3 (NP_005154.2). |
---|---|
Sequence | GTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
Gene ID | |
Swiss Prot | |
Synonyms | AKT1/AKT2/AKT3; Pan-Akt |
Calculated MW | 48kDa/55kDa/51kDa/54kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | MCF7, Mouse brain, Rat brain |
Cellular location | ciliary basal body, cytoplasm, cytosol, microtubule cytoskeleton, mitochondrion, nucleoplasm, nucleus, plasma membrane, spindle. |
Customer validation | IF(Homo sapiens) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Mus musculus, Sus scrofa, Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18120? Please let us know so that we can cite the reference in this datasheet.