제품 > 항체 > 단일클론항체(mAb)

Pannexin 1 Rabbit mAb (A5167)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Pannexin 1 Rabbit mAb (A5167) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Pannexin 1 Rabbit mAb (A5167)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Pannexin 1 Rabbit mAb (A5167) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	Pannexin 1 Rabbit mAb
Catalog No.	A5167
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1207

Background

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin 1 (Q96RD7).
Sequence	DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Gene ID
Swiss Prot
Synonyms	PX1; MRS1; OOMD7; OZEMA7; UNQ2529; Pannexin 1
Calculated MW	48kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	C2C12, K-562, U-87 MG, Mouse brain, Rat brain
Cellular location	Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Multi-pass membrane protein, gap junction