Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pannexin 1 Rabbit mAb |
---|---|
Catalog No. | A5167 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1207 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin 1 (Q96RD7). |
---|---|
Sequence | DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
Gene ID | |
Swiss Prot | |
Synonyms | PX1; MRS1; OOMD7; OZEMA7; UNQ2529; Pannexin 1 |
Calculated MW | 48kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | C2C12, K-562, U-87 MG, Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Multi-pass membrane protein, gap junction |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.