제품 > 항체 > 다중클론항체(pAb)

Pea3 / ETV4 Rabbit pAb (A5797)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Pea3 / ETV4 Rabbit pAb (A5797) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - Pea3 / ETV4 Rabbit pAb (A5797)

Immunohistochemistry analysis of paraffin-embedded Human skin using Pea3 / ETV4 Rabbit pAb (A5797) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse skin using Pea3 / ETV4 Rabbit pAb (A5797) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat skin using Pea3 / ETV4 Rabbit pAb (A5797) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Pea3 / ETV4 Rabbit pAb (A5797)

Immunofluorescence analysis of U-2 OS cells using Pea3 / ETV4 Rabbit pAb (A5797) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Pea3 / ETV4 Rabbit pAb
Catalog No.	A5797
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of keratinocyte differentiation and positive regulation of transcription by RNA polymerase II. Located in chromosome and nucleolus.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 1-284 of human ETV4 (NP_001977.1).
Sequence	MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEG
Gene ID
Swiss Prot
Synonyms	E1AF; PEA3; E1A-F; PEAS3; Pea3 / ETV4
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, SW480, Mouse stomach, Mouse heart, Rat heart,
Cellular location	Nucleus
Customer validation	IHC(Homo sapiens) WB(Homo sapiens, Mus musculus) IF(Rattus norvegicus) IHC(Rattus norvegicus) WB(Rattus norvegicus)