Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Phospho-p70 S6 Kinase 1-T421/S424 Rabbit mAb |
---|---|
Catalog No. | AP0502 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0107 |
Immunogen | A synthetic phosphorylated peptide around T421&S424 of human Phospho S6K1(NP_001258989.1). |
---|---|
Sequence | SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL |
Gene ID | |
Swiss Prot | |
Synonyms | S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha; Phospho-p70 S6 Kinase 1-T421/S424 |
Calculated MW | 59kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | NIH/3T3 treated by 10% FBS, C6 treated by 10% FBS |
Cellular location | Cell junction, Cytoplasm, Mitochondrion outer membrane, Mitochondrion, Nucleus, synapse, synaptosome. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Homo sapiens) IF(Mus musculus) WB(Mus musculus) FC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using AP0502? Please let us know so that we can cite the reference in this datasheet.