Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Proprotein Convertase 9(PCSK9) Rabbit mAb |
---|---|
Catalog No. | A21909 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0695 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Proprotein Convertase 9(PCSK9) (Q8NBP7). |
---|---|
Sequence | MEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC |
Gene ID | |
Swiss Prot | |
Synonyms | FH3; PC9; FHCL3; NARC1; LDLCQ1; NARC-1; HCHOLA3; Proprotein Convertase 9(PCSK9) |
Calculated MW | 74kDa |
Observed MW | Refer to figures |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | |
Cellular location | Cell surface, Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Lysosome, Secreted. |
Customer validation | (小鼠心脏组织) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A21909? Please let us know so that we can cite the reference in this datasheet.