제품 > 항체 > 다중클론항체(pAb)

RAB5B Rabbit pAb (A7447)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RAB5B Rabbit pAb (A7447) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunofluorescence - RAB5B Rabbit pAb (A7447)

Immunofluorescence analysis of L929 cells using RAB5B Rabbit pAb (A7447) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded human colon carcinoma using RAB5B Rabbit pAb (A7447) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RAB5B Rabbit pAb
Catalog No.	A7447
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables GDP binding activity; GTP-dependent protein binding activity; and GTPase activity. Involved in antigen processing and presentation and plasma membrane to endosome transport. Located in endosome and extracellular exosome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB5B (NP_002859.1).
Sequence	YDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVD
Gene ID
Swiss Prot
Synonyms	RAB5B
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, SKOV3, Mouse ovary, Rat brain
Cellular location	Cell membrane, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome.
Customer validation	WB(Mus musculus)