제품 > 항체 > 단일클론항체(mAb)

RAB8A Rabbit mAb (A20976)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RAB8A Rabbit mAb (A20976) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from Rat spinal cord, using RAB8A Rabbit mAb (A20976) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - RAB8A Rabbit mAb (A20976)

Immunofluorescence analysis of NIH/3T3 cells using RAB8A Rabbit mAb (A20976) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using RAB8A Rabbit mAb (A20976) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - RAB8A Rabbit mAb (A20976)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg RAB8A antibody (A20976). Western blot was performed from the immunoprecipitate using RAB8A antibody (A20976) at a dilution of 1:1000.

Overview

Product name	RAB8A Rabbit mAb
Catalog No.	A20976
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2968

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-207 of human RAB8A (P61006).
Sequence	RNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Gene ID
Swiss Prot
Synonyms	MEL; RAB8; RAB8A
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, HCT 116, Mouse brain, Mouse thymus, Rat spinal cord
Cellular location	Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus, Lipid-anchor, Recycling endosome membrane, centriole, centrosome, cilium, cilium basal body, cytoskeleton, microtubule organizing center, phagosome, phagosome membrane