제품 > 항체 > 단일클론항체(mAb)

RPS19 Rabbit mAb (A3675)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RPS19 Rabbit mAb (A3675) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - RPS19 Rabbit mAb (A3675)

Confocal imaging of paraffin-embedded Human testis using RPS19 Rabbit mAb (A3675, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Confocal imaging of C6 cells using RPS19 Rabbit mAb (A3675, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - RPS19 Rabbit mAb (A3675)

Immunoprecipitation of RPS19 in 300 µg extracts from 293F cells using 3 µg RPS19 Rabbit mAb (A3675). Western blot analysis was performed using RPS19 Rabbit mAb (A3675) at 1:1000 dilution.

Overview

Product name	RPS19 Rabbit mAb
Catalog No.	A3675
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0820

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 66-145 of human RPS19 (P39019).
Sequence	LRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
Gene ID
Swiss Prot
Synonyms	DBA; S19; DBA1; eS19; LOH19CR1; RPS19
Calculated MW	16kDa
Observed MW	16kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HT-29, 293T, K-562, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat spleen, Rat kidney, 293F
Cellular location	Nucleus, Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RPS19 Rabbit mAb images

Western blot - RPS19 Rabbit mAb (A3675)

Immunofluorescence - RPS19 Rabbit mAb (A3675)

Immunoprecipitation - RPS19 Rabbit mAb (A3675)

Immunoprecipitation of RPS19 in 300 µg extracts from 293F cells using 3 µg RPS19 Rabbit mAb (A3675). Western blot analysis was performed using RPS19 Rabbit mAb (A3675) at 1:1000 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.