제품 > 항체 > 단일클론항체(mAb)

RPS20 Rabbit mAb (A9551)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RPS20 Rabbit mAb (A9551) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - RPS20 Rabbit mAb (A9551)

Immunohistochemistry analysis of RPS20 in paraffin-embedded human colon carcinoma tissue using RPS20 Rabbit mAb (A9551) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse brain tissue using RPS20 Rabbit mAb (A9551) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse testis tissue using RPS20 Rabbit mAb (A9551) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RPS20 in paraffin-embedded rat brain tissue using RPS20 Rabbit mAb (A9551) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RPS20 in paraffin-embedded rat colon tissue using RPS20 Rabbit mAb (A9551) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - RPS20 Rabbit mAb (A9551)

Immunofluorescence analysis of C6 cells using RPS20 Rabbit mAb (A9551) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - RPS20 Rabbit mAb (A9551)

Immunoprecipitation of RPS20 in 300 µg extracts from Hep G2 cells using 3 µg RPS20 Rabbit mAb (A9551). Western blot analysis was performed using RPS20 Rabbit mAb (A9551) at 1:1000 dilution.

Overview

Product name	RPS20 Rabbit mAb
Catalog No.	A9551
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1630

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10P family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the small nucleolar RNA gene U54, which is located in its second intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two transcript variants encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPS20 (P60866).
Sequence	MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ
Gene ID
Swiss Prot
Synonyms	S20; uS10; RPS20
Calculated MW	13kDa
Observed MW	15kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Hep G2, Jurkat, Mouse testis, Mouse spleen, Rat lung, Rat testis, Rat spleen, Hep G2
Cellular location	Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달RNA 결합

RPS20 Rabbit mAb images

Western blot - RPS20 Rabbit mAb (A9551)

Immunohistochemistry - RPS20 Rabbit mAb (A9551)

Immunofluorescence - RPS20 Rabbit mAb (A9551)

Immunoprecipitation - RPS20 Rabbit mAb (A9551)

Immunoprecipitation of RPS20 in 300 µg extracts from Hep G2 cells using 3 µg RPS20 Rabbit mAb (A9551). Western blot analysis was performed using RPS20 Rabbit mAb (A9551) at 1:1000 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.