제품 > 항체 > 다중클론항체(pAb)

RSL24D1 Rabbit pAb (A17700)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using RSL24D1 Rabbit pAb (A17700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	RSL24D1 Rabbit pAb
Catalog No.	A17700
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1).
Sequence	SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK
Gene ID
Swiss Prot
Synonyms	L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso; RSL24D1
Calculated MW	20kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, HepG2, Mouse spleen
Cellular location	nucleolus, nucleoplasm