Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RYR2 Rabbit pAb |
---|---|
Catalog No. | A0298 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 4868-4967 of human RYR2 (NP_001026.2). |
---|---|
Sequence | DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN |
Gene ID | |
Swiss Prot | |
Synonyms | RyR; ARVC2; ARVD2; RYR-2; VTSIP; VACRDS; RYR2 |
Calculated MW | 565kDa |
Observed MW | 564kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse heart |
Cellular location | Membrane, Multi-pass membrane protein, Sarcoplasmic reticulum membrane. |
Customer validation | WB(Mus musculus,Rattus norvegicus, Gallus gallus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0298? Please let us know so that we can cite the reference in this datasheet.