Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | S6 Ribosomal Protein (RPS6) Rabbit mAb |
---|---|
Catalog No. | A11874 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50655 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). |
---|---|
Sequence | MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP |
Gene ID | |
Swiss Prot | |
Synonyms | S6; eS6; S6 Ribosomal Protein (RPS6) |
Calculated MW | 29kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, NIH/3T3, Mouse thymus, Mouse liver, Rat liver |
Cellular location | cytoplasm, cytoplasmic ribonucleoprotein granule, cytosol, cytosolic ribosome, endoplasmic reticulum, nucleolus, nucleoplasm, nucleus, perinuclear region of cytoplasm. |
Customer validation | WB(Danio rerio, Homo sapiens, Mus musculus) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11874? Please let us know so that we can cite the reference in this datasheet.