제품 > 항체 > 다중클론항체(pAb)

SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:SARS-CoV-2

ABclonal:Western blot - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Western blot analysis of extracts of normal 293T cells and 293T transfected with Spike RBD Protein, using SARS-CoV-2 Spike RBD Rabbit pAb (A20135) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal: - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Immobilized Recombinant SARS-COV-2 Spike RBD Protein (RP01278LQ) at 1μg/mL (100μL/well) can bind SARS-CoV-2 Spike RBD Rabbit pAb (A20135) with a linear range of 0.78-50ng/mL.

ABclonal:Immunofluorescence - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Immunofluorescence analysis of 293T-RBD and 293T cells using SARS-CoV-2 Spike RBD Rabbit pAb (A20135) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SARS-CoV-2 Spike RBD antibody (A20135). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike RBD antibody (A20135) at a dilution of 1:3000.

Overview

Product name	SARS-CoV-2 Spike RBD Rabbit pAb
Catalog No.	A20135
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 332-550 of coronavirus Spike RBD (YP_009724390.1).
Sequence	ITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG
Gene ID
Swiss Prot
Synonyms	spike glycoprotein; SARS-CoV-2 Spike RBD
Calculated MW	141kDa
Observed MW	30kDa

Applications

Reactivity	SARS-CoV-2
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA 1:50000-1:200000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T
Cellular location
Customer validation	FC(Homo sapiens) WB(Other) ELISA(Other)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SARS-CoV-2 Spike RBD Rabbit pAb images

Western blot - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

- SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Immobilized Recombinant SARS-COV-2 Spike RBD Protein (RP01278LQ) at 1μg/mL (100μL/well) can bind SARS-CoV-2 Spike RBD Rabbit pAb (A20135) with a linear range of 0.78-50ng/mL.

Immunofluorescence - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

Immunoprecipitation - SARS-CoV-2 Spike RBD Rabbit pAb (A20135)

* For research use only. Not for therapeutic or diagnostic purposes.