제품 > 항체 > 다중클론항체(pAb)

SARS-CoV-2 Spike Rabbit pAb (A20137)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:SARS-CoV-2

ABclonal:Western blot - SARS-CoV-2 Spike Rabbit pAb (A20137)

Western blot analysis of extracts of 293T and transfected 293T-S1（His-tag), using SARS-CoV-2 Spike Rabbit pAb (A20137) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of 293T and transfected 293T-S ECD（His-tag), using SARS-CoV-2 Spike Rabbit pAb (A20137) at 1:1000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Dot Blot - SARS-CoV-2 Spike Rabbit pAb (A20137)

Immobilized Recombinant SARS-COV-2 S1+S2 ECD(S-ECD) Protein (RP01283) at 1μg/mL (100μL/well) can bind SARS-CoV-2 Spike Rabbit pAb (A20137) with a linear range of 0.78-50ng/mL.

ABclonal:Immunofluorescence - SARS-CoV-2 Spike Rabbit pAb (A20137)

Immunofluorescence analysis of 293T cells transfected with SARS-CoV-2 Spike protein and untreated 293T cells use SARS-CoV-2 Spike Rabbit pAb (A20137) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SARS-CoV-2 Spike Rabbit pAb (A20137)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SARS-CoV-2 Spike antibody (A20137). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike antibody (A20137) at a dilution of 1:1000.

Overview

Product name	SARS-CoV-2 Spike Rabbit pAb
Catalog No.	A20137
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (YP_009724390.1).
Sequence	PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG
Gene ID
Swiss Prot
Synonyms	spike glycoprotein; SARS-CoV-2 Spike
Calculated MW	141kDa
Observed MW	110kDa/180kDa

Applications

Reactivity	SARS-CoV-2
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 DB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T
Cellular location
Customer validation	IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SARS-CoV-2 Spike Rabbit pAb images

Western blot - SARS-CoV-2 Spike Rabbit pAb (A20137)

Dot Blot - SARS-CoV-2 Spike Rabbit pAb (A20137)

Immobilized Recombinant SARS-COV-2 S1+S2 ECD(S-ECD) Protein (RP01283) at 1μg/mL (100μL/well) can bind SARS-CoV-2 Spike Rabbit pAb (A20137) with a linear range of 0.78-50ng/mL.

Immunofluorescence - SARS-CoV-2 Spike Rabbit pAb (A20137)

Immunoprecipitation - SARS-CoV-2 Spike Rabbit pAb (A20137)

* For research use only. Not for therapeutic or diagnostic purposes.