제품 > 항체 > 다중클론항체(pAb)

SARS-CoV-2 Spike S2 Rabbit pAb (A20284)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:SARS-CoV-2

Western blot analysis of extracts of normal 293T cells and 293T transfected with Spike S2 Protein, using SARS-CoV-2 Spike S2 Rabbit pAb (A20284) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunoprecipitation - SARS-CoV-2 Spike S2 Rabbit pAb (A20284)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SARS-CoV-2 Spike S2 antibody (A20284). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike S2 antibody (A20284) at a dilution of 1:3000.

Overview

Product name	SARS-CoV-2 Spike S2 Rabbit pAb
Catalog No.	A20284
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1).
Sequence	ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
Gene ID
Swiss Prot
Synonyms	spike glycoprotein; SARS-CoV-2 Spike S2
Calculated MW	141kDa
Observed MW	36kDa

Applications

Reactivity	SARS-CoV-2
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T
Cellular location