Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SCD Rabbit pAb |
---|---|
Catalog No. | A16429 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCD (NP_005054.3). |
---|---|
Sequence | MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT |
Gene ID | |
Swiss Prot | |
Synonyms | SCD1; FADS5; SCDOS; hSCD1; MSTP008; SCD |
Calculated MW | 42kDa |
Observed MW | 37kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-251MG, Mouse liver, Rat brain |
Cellular location | Endoplasmic reticulum membrane, Multi-pass membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Mus musculus, Homo sapiens) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16429? Please let us know so that we can cite the reference in this datasheet.