Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SDHB Rabbit mAb |
---|---|
Catalog No. | A1809 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0733 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912). |
---|---|
Sequence | DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV |
Gene ID | |
Swiss Prot | |
Synonyms | IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP; MC2DN4; SDHB |
Calculated MW | 32kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Hep G2, U-87MG, Mouse lung, Mouse liver, Mouse brain, Rat liver, Rat brain |
Cellular location | Matrix side, Mitochondrion inner membrane, Peripheral membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1809? Please let us know so that we can cite the reference in this datasheet.