Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SEH1L Rabbit pAb |
---|---|
Catalog No. | A20759 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-360 of human SEH1L (NP_112493.2). |
---|---|
Sequence | SGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS |
Gene ID | |
Swiss Prot | |
Synonyms | Seh1; SEH1A; SEH1B; SEC13L; SEH1L |
Calculated MW | 40kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | K-562, Mouse kidney, Rat kidney, Rat thymus |
Cellular location | cytosol, nuclear envelope, nuclear pore, nuclear pore outer ring |
* For research use only. Not for therapeutic or diagnostic purposes.