제품 > 항체 > 다중클론항체(pAb)

SETD1B Rabbit pAb (A20155)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SETD1B Rabbit pAb (A20155) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	SETD1B Rabbit pAb
Catalog No.	A20155
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

SET1B is a component of a histone methyltransferase complex that produces trimethylated histone H3 at Lys4 (Lee et al., 2007 [PubMed 17355966]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1673-1770 of human SETD1B (NP_001340274.1).
Sequence	SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRAS
Gene ID
Swiss Prot
Synonyms	KMT2G; Set1B; IDDSELD; SETD1B
Calculated MW	213kDa
Observed MW	250kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Rat lung
Cellular location	histone methyltransferase complex, nuclear speck, nucleoplasm
Customer validation	IP(Mus musculus)