Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SLC35D3 Rabbit pAb |
---|---|
Catalog No. | A17880 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1). |
---|---|
Sequence | NYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYL |
Gene ID | |
Swiss Prot | |
Synonyms | FRCL1; SLC35D3 |
Calculated MW | 44kDa |
Observed MW | 44kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, K-562 |
Cellular location | early endosome, endoplasmic reticulum, Golgi apparatus |
* For research use only. Not for therapeutic or diagnostic purposes.