Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of lysates from Rat lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Rat small intestine using SMMHC/MYH11 Rabbit mAb (A4064, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Human colon using SMMHC/MYH11 Rabbit mAb (A4064, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
| Product name | SMMHC/MYH11 Rabbit mAb |
|---|---|
| Catalog No. | A4064 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC51911 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). |
|---|---|
| Sequence | DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1; SMMHC/MYH11 |
| Calculated MW | 227kDa |
| Observed MW | 250kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse lung, Rat lung |
| Cellular location | Cytoplasm, Melanosome. |
| Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Sus scrofa, Homo sapiens) mIHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4064? Please let us know so that we can cite the reference in this datasheet.
