Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SOX2 Rabbit mAb |
---|---|
Catalog No. | A19118 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0449 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX2 (NP_003097.1). |
---|---|
Sequence | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL |
Gene ID | |
Swiss Prot | |
Synonyms | ANOP3; MCOPS3; SOX2 |
Calculated MW | 34kDa |
Observed MW | 38kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Rat brain, 293T |
Cellular location | Nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Homo sapiens, mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19118? Please let us know so that we can cite the reference in this datasheet.