제품 > 항체 > 단일클론항체(mAb)

SOX2 Rabbit mAb (A19118)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using SOX2 Rabbit mAb (A19118) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - SOX2 Rabbit mAb (A19118)

Confocal imaging of mouse brain(frozen section) using SOX2 Rabbit mAb (A19118, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Overview

Product name	SOX2 Rabbit mAb
Catalog No.	A19118
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0449

Background

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX2 (NP_003097.1).
Sequence	MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
Gene ID
Swiss Prot
Synonyms	ANOP3; MCOPS3; SOX2
Calculated MW	34kDa
Observed MW	38kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain, Rat brain, 293T
Cellular location	Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus) IF(Homo sapiens, mus musculus) WB(Homo sapiens)