Reviews (2)Publications (29) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SOX2 Rabbit pAb |
---|---|
Catalog No. | A0561 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1). |
---|---|
Sequence | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA |
Gene ID | |
Swiss Prot | |
Synonyms | ANOP3; MCOPS3; SOX2 |
Calculated MW | 34kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, MCF7, Mouse lung, Rat brain |
Cellular location | Nucleus. |
Customer validation | (neural progenitors , mouse brain) IP(Homo sapiens) WB(Homo sapiens, Mus musculus) IHC(Mus musculus, Homo sapiens) IF(Gallus gallus, Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0561? Please let us know so that we can cite the reference in this datasheet.