제품 > 항체 > 다중클론항체(pAb)

STIM1 Rabbit pAb (A7411)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using STIM1 Rabbit pAb (A7411) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - STIM1 Rabbit pAb (A7411)

Immunofluorescence analysis of HeLa cells using STIM1 Rabbit pAb (A7411) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using STIM1 Rabbit pAb (A7411) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of K-562 cells using STIM1 Rabbit pAb (A7411) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - STIM1 Rabbit pAb (A7411)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STIM1 antibody (A7411). Western blot was performed from the immunoprecipitate using STIM1 (A7411) at a dilution of 1:1000.

Overview

Product name	STIM1 Rabbit pAb
Catalog No.	A7411
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a type 1 transmembrane protein that mediates Ca2+ influx after depletion of intracellular Ca2+ stores by gating of store-operated Ca2+ influx channels (SOCs). It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region, as well as early hematopoiesis, by mediating attachment to stromal cells. Mutations in this gene are associated with fatal classic Kaposi sarcoma, immunodeficiency due to defects in store-operated calcium entry (SOCE) in fibroblasts, ectodermal dysplasia and tubular aggregate myopathy. This gene is oriented in a head-to-tail configuration with the ribonucleotide reductase 1 gene (RRM1), with the 3' end of this gene situated 1.6 kb from the 5' end of the RRM1 gene. Alternative splicing of this gene results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2).
Sequence	RQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
Gene ID
Swiss Prot
Synonyms	GOK; TAM; TAM1; IMD10; STRMK; D11S4896E; STIM1
Calculated MW	77kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	K-562, HeLa, Jurkat, MCF7
Cellular location	Cell membrane, Cytoplasm, Endoplasmic reticulum membrane, Single-pass type I membrane protein, cytoskeleton
Customer validation	WB(Mus musculus, Homo sapiens, Chlorocebus aethiops )

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

STIM1 Rabbit pAb images

Western blot - STIM1 Rabbit pAb (A7411)

Immunofluorescence - STIM1 Rabbit pAb (A7411)

Immunoprecipitation - STIM1 Rabbit pAb (A7411)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STIM1 antibody (A7411). Western blot was performed from the immunoprecipitate using STIM1 (A7411) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.