Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STMN2 Rabbit pAb |
---|---|
Catalog No. | A2997 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STMN2 (NP_008960.2). |
---|---|
Sequence | MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLS |
Gene ID | |
Swiss Prot | |
Synonyms | SCG10; SCGN10; STMN2 |
Calculated MW | 21kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG |
Cellular location | Cell projection, Cytoplasm, Cytoplasmic side, Endosome, Golgi apparatus, Membrane, Peripheral membrane protein, axon, growth cone, lamellipodium, perinuclear region |
* For research use only. Not for therapeutic or diagnostic purposes.