Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STX1A Rabbit mAb |
---|---|
Catalog No. | A19243 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2403 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STX1A (Q16623). |
---|---|
Sequence | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI |
Gene ID | |
Swiss Prot | |
Synonyms | STX1; HPC-1; P35-1; SYN1A; STX1A |
Calculated MW | 33kDa |
Observed MW | 33kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | C6, U-87MG, Rat brain, HepG2, Mouse lung |
Cellular location | Cell junction, Cell membrane, Cytoplasmic vesicle, Secreted, Single-pass type IV membrane protein, Secretory vesicle, Synapse, Synaptic vesicle membrane, Synaptosome |
Customer validation | WB(Mus musculus, Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19243? Please let us know so that we can cite the reference in this datasheet.