제품 > 항체 > 단일클론항체(mAb)

Semaphorin 4D / CD100 Rabbit mAb (A21070)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using Semaphorin 4D / CD100 Rabbit mAb (A21070) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Semaphorin 4D / CD100 Rabbit mAb (A21070)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Semaphorin 4D / CD100 Rabbit mAb (A21070) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Semaphorin 4D / CD100 Rabbit mAb
Catalog No.	A21070
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2801

Background

Enables identical protein binding activity; semaphorin receptor binding activity; and transmembrane signaling receptor activity. Involved in several processes, including positive regulation of phosphatidylinositol 3-kinase signaling; regulation of neuron projection development; and regulation of phosphate metabolic process. Is integral component of plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Semaphorin 4D / CD100 (NP_006369.3).
Sequence	KGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTE
Gene ID
Swiss Prot
Synonyms	A8; GR3; BB18; CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G; Semaphorin 4D / CD100
Calculated MW	96kDa
Observed MW	140kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Daudi
Cellular location	Cell membrane