Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Slc39a11 Rabbit pAb |
---|---|
Catalog No. | A20338 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-174 of mouse Slc39a11 (NP_001159975.1). |
---|---|
Sequence | HLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVA |
Gene ID | |
Swiss Prot | |
Synonyms | ZIP-11; 1810074D23Rik; Slc39a11 |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse testis, Rat testis |
Cellular location | cytoplasm, Golgi apparatus, nucleus, plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.