제품 > 항체 > 다중클론항체(pAb)

Slc39a11 Rabbit pAb (A20338)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Slc39a11 Rabbit pAb (A20338) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Slc39a11 Rabbit pAb (A20338)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Slc39a11 Rabbit pAb (A20338) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using Slc39a11 Rabbit pAb (A20338) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Slc39a11 Rabbit pAb (A20338) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using Slc39a11 Rabbit pAb (A20338) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat stomach using Slc39a11 Rabbit pAb (A20338) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Slc39a11 Rabbit pAb
Catalog No.	A20338
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables zinc ion transmembrane transporter activity. Predicted to be involved in zinc ion transmembrane transport. Predicted to act upstream of or within zinc ion transport. Located in Golgi apparatus; nucleus; and plasma membrane. Orthologous to human SLC39A11 (solute carrier family 39 member 11).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 101-174 of mouse Slc39a11 (NP_001159975.1).
Sequence	HLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVA
Gene ID
Swiss Prot
Synonyms	ZIP-11; 1810074D23Rik; Slc39a11
Calculated MW	35kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse testis, Rat testis
Cellular location	cytoplasm, Golgi apparatus, nucleus, plasma membrane