Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse heart, using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat rectum using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded human smooth muscle using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A1011) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | α-Smooth Muscle Actin (ACTA2) Rabbit pAb |
|---|---|
| Catalog No. | A1011 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1). |
|---|---|
| Sequence | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ACTSA; α-Smooth Muscle Actin (ACTA2) |
| Calculated MW | 42kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse heart |
| Cellular location | Cytoplasm, cytoskeleton. |
| Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Mus musculus, Other) IHC(Rattus norvegicus, Mus musculus) IF(Homo sapiens, Mus musculus) FC(Homo sapiens) ELISA(Homo sapiens) WB(Homo sapiens) IF(Mus musculus, Rattus norvegicus) WB(Homo sapiens, Mus musculus) IHC(Mus musculus) FC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1011? Please let us know so that we can cite the reference in this datasheet.
