Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse heart, using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded human liver cancer tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded mouse testis tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded rat colon tissue using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded Human colon CA using α-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | α-Smooth Muscle Actin (ACTA2) Rabbit pAb |
|---|---|
| Catalog No. | A7248 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1). |
|---|---|
| Sequence | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ACTSA; α-Smooth Muscle Actin (ACTA2) |
| Calculated MW | 42kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse heart |
| Cellular location | Cytoplasm, cytoskeleton. |
| Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus, Mus musculus, Zea mays, Canis familiaris) IF(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Mus musculus, Rattus norvegicus) IHC(Rattus norvegicus, Mus musculus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7248? Please let us know so that we can cite the reference in this datasheet.
