Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Synaptophysin Rabbit pAb |
---|---|
Catalog No. | A6344 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 222-313 of human Synaptophysin (NP_003170.1). |
---|---|
Sequence | VFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Gene ID | |
Swiss Prot | |
Synonyms | MRX96; MRXSYP; XLID96; Synaptophysin |
Calculated MW | 34kDa |
Observed MW | 38kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | SH-SY5Y, Mouse lung, Mouse kidney, Rat lung |
Cellular location | Cell junction, Cytoplasmic vesicle, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome. |
Customer validation | (Mouse tibialis anterior muscle) WB(Mus musculus, Vaccinium myrtillus L, Homo sapiens, Rattus norvegicus, Homo sapiens) IHC(Rattus norvegicus, Mus musculus) IF(Mus musculus, Homo sapiens) IHC(Rattus norvegicus) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6344? Please let us know so that we can cite the reference in this datasheet.