Review (1)Publications (17) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Synaptophysin Rabbit pAb (A6344) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human brain using Synaptophysin Rabbit pAb (A6344) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse pancreatic islet using Synaptophysin Rabbit pAb (A6344) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain using Synaptophysin Rabbit pAb (A6344) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Neuro-2a cells using Synaptophysin Rabbit pAb (A6344) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of SH-SY5Y cells using Synaptophysin Rabbit pAb (A6344) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded rat brain using Synaptophysin Rabbit pAb (A6344) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded human pancreas using Synaptophysin Rabbit pAb (A6344) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse brain using Synaptophysin Rabbit pAb (A6344) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg Synaptophysin antibody (A6344). Western blot was performed from the immunoprecipitate using Synaptophysin antibody (A6344) at a dilution of 1:1000.
| Product name | Synaptophysin Rabbit pAb |
|---|---|
| Catalog No. | A6344 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 222-313 of human Synaptophysin (NP_003170.1). |
|---|---|
| Sequence | VFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MRX96; MRXSYP; XLID96; Synaptophysin |
| Calculated MW | 34kDa |
| Observed MW | 38kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | SH-SY5Y, Mouse lung, Mouse kidney, Rat lung |
| Cellular location | Cell junction, Cytoplasmic vesicle, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome. |
| Customer validation | (Mouse tibialis anterior muscle) WB(Mus musculus, Vaccinium myrtillus L, Homo sapiens, Rattus norvegicus, Homo sapiens) IHC(Rattus norvegicus, Mus musculus) IF(Mus musculus, Homo sapiens) IHC(Rattus norvegicus) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6344? Please let us know so that we can cite the reference in this datasheet.
