제품 > 항체 > 단일클론항체(mAb)

α-Synuclein Rabbit mAb (A24950)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using α-Synuclein Rabbit mAb (A24950) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): T-47D
Exposure time: 90s.

ABclonal:Immunohistochemistry - α-Synuclein Rabbit mAb (A24950)

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using α-Synuclein Rabbit mAb (A24950) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - α-Synuclein Rabbit mAb (A24950)

Confocal imaging of HEL cells using α-Synuclein Rabbit mAb (A24950, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded human brain using α-Synuclein Rabbit mAb (A24950, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded mouse brain using α-Synuclein Rabbit mAb (A24950, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded rat brain using α-Synuclein Rabbit mAb (A24950, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - α-Synuclein Rabbit mAb (A24950)

Immunoprecipitation of α-Synuclein in 500 µg extracts from HEL cells using 2 µg α-Synuclein Rabbit mAb (A24950). Western blot analysis was performed using α-Synuclein Rabbit mAb (A24951) at 1:3000 dilution.

Overview

Product name	α-Synuclein Rabbit mAb
Catalog No.	A24950
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64511

Background

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human α-Synuclein(NP_000336.1).
Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Gene ID
Swiss Prot
Synonyms	PD1; NACP; PARK1; PARK4; α-Synuclein
Calculated MW	14kDa
Observed MW	18kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:2000 IF/ICC 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HEL,
Cellular location	Cell junction, Cytoplasm, Membrane, Nucleus, Secreted, cytosol, synapse, Cell projection, axon .