Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Rat lung using TEAD1 Rabbit pAb (A6768) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.
Western blot analysis of various lysates using TEAD1 Rabbit pAb (A6768) at 1:700 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 28s.
Immunohistochemistry analysis of paraffin-embedded Human liver using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of MCF7 cells using TEAD1 Rabbit pAb (A6768).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.
Immunoprecipitation of TEAD1 in 600 µg extracts from mouse heart using 3 µg TEAD1 Rabbit pAb (A6768). Western blot analysis was performed using TEAD1 Rabbit pAb (A6768) at 1:200 dilution.
| Product name | TEAD1 Rabbit pAb |
|---|---|
| Catalog No. | A6768 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). |
|---|---|
| Sequence | AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1 |
| Calculated MW | 48kDa |
| Observed MW | 60kDa/50kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | Rat lung, Mouse lung, Mouse heart |
| Cellular location | Nucleus. |
| Customer validation | WB(Homo sapiens, Mus musculus, Xenopus laevis) IHC(Homo sapiens) Co-IP(Homo sapiens) IF(Mus musculus) ChIP(Mus musculus) qPCR(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6768? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1721360826 "ABclonal:Western blot - TEAD1 Rabbit pAb (A6768)")
_IP_02.jpg?t=1721360826 "ABclonal:Immunoprecipitation - TEAD1 Rabbit pAb (A6768)")
