Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TFAM Rabbit pAb |
---|---|
Catalog No. | A13552 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1). |
---|---|
Sequence | QDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY |
Gene ID | |
Swiss Prot | |
Synonyms | TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM |
Calculated MW | 29kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, HepG2, K-562 |
Cellular location | Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid. |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus, Danio rerio, Other) IHC(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus) WB(Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13552? Please let us know so that we can cite the reference in this datasheet.