제품 > 항체 > 다중클론항체(pAb)

TFAM Rabbit pAb (A1926)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TFAM Rabbit pAb (A1926) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - TFAM Rabbit pAb (A1926)

Immunofluorescence analysis of U2OS cells using TFAM Rabbit pAb (A1926). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of U2OS cells using TFAM Rabbit pAb (A1926) at dilution of 1:100. Blue: DAPI for nuclear staining.

Review

Overview

Product name	TFAM Rabbit pAb
Catalog No.	A1926
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TFAM (NP_003192.1).
Sequence	MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEE
Gene ID
Swiss Prot
Synonyms	TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM
Calculated MW	29kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SW620, CEM, HepG2, HT-29
Cellular location	Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid.
Customer validation	(769-P;769-P TFAM OE, HK2, Mouse kidney) WB(Homo sapiens, Mus musculus) IF(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TFAM Rabbit pAb images

Western blot - TFAM Rabbit pAb (A1926)

Immunofluorescence - TFAM Rabbit pAb (A1926)

Immunofluorescence analysis of U2OS cells using TFAM Rabbit pAb (A1926). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence - TFAM Rabbit pAb (A1926)

Confocal immunofluorescence analysis of U2OS cells using TFAM Rabbit pAb (A1926) at dilution of 1:100. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.