Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, African green monkey
Product name | TIMP2 Rabbit mAb |
---|---|
Catalog No. | A20766 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51187 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human TIMP2. (NP_003246.1). |
---|---|
Sequence | GKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
Gene ID | |
Swiss Prot | |
Synonyms | DDC8; CSC-21K; TIMP2 |
Calculated MW | 24kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat, African green monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y, HT-1080, Rat brain, COS-7, Mouse testis, Mouse brain, Mouse lung |
Cellular location | Secreted |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20766? Please let us know so that we can cite the reference in this datasheet.