제품 > 항체 > 단일클론항체(mAb)

TROP-2 Rabbit mAb (A20824)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

The multiplex IHC analysis on paraffin-embedded Human cervical cancer tissue using the following specific primary antibodies and tyramide signal amplification (TSA) reagents (RK05903) : TROP-2 Rabbit mAb (A20824, 1:8000) with TSA-TYR-520 (Green), CD34 Rabbit mAb (A19015, 1:100) with TSA-TYR-570 (Red), and Ki67 Rabbit mAb (A20018, 1:500) with TSA-TYR-690 (Magenta). DAPI (Blue) was used for nuclear staining. Prior to multiplex IHC staining, high-pressure antigen retrieval was performed using 0.01M citrate buffer at pH 6.0. The analysis was completed using a 20x objective lens.

The multiplex IHC analysis on paraffin-embedded Human breast cancer tissue using the following specific primary antibodies and tyramide signal amplification (TSA) reagents (RK05903) : TROP-2 Rabbit mAb (A20824, 1:8000) with TSA-TYR-520 (Green), CD34 Rabbit mAb (A19015, 1:100) with TSA-TYR-570 (Red), and Ki67 Rabbit mAb (A20018, 1:500) with TSA-TYR-690 (Magenta). DAPI (Blue) was used for nuclear staining. Prior to multiplex IHC staining, high-pressure antigen retrieval was performed using 0.01M citrate buffer at pH 6.0. The analysis was completed using a 20x objective lens.

ABclonal:Western blot - TROP-2 Rabbit mAb (A20824)

Western blot analysis of various lysates using TROP-2 Rabbit mAb (A20824) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - TROP-2 Rabbit mAb (A20824)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophageal tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - TROP-2 Rabbit mAb (A20824)

Confocal imaging of MCF7 cells using TROP-2 Rabbit mAb (A20824, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	TROP-2 Rabbit mAb
Catalog No.	A20824
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51513

Background

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID
Swiss Prot
Synonyms	EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; TROP-2
Calculated MW	36kDa
Observed MW	40-65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:2000 - 1:10000 IF/ICC 1:100 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MCF7 cells, A-431 cells, Mouse testis, Mouse kidney, Rat kidney
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens)