제품 > 항체 > 단일클론항체(mAb)

TSC2 Rabbit mAb (A19540)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using TSC2 Rabbit mAb (A19540) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - TSC2 Rabbit mAb (A19540)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg TSC2 antibody (A19540). Western blot was performed from the immunoprecipitate using TSC2 antibody (A19540) at a dilution of 1:1000.

Overview

Product name	TSC2 Rabbit mAb
Catalog No.	A19540
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0019

Background

This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815).
Sequence	AKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
Gene ID
Swiss Prot
Synonyms	LAM; TSC4; PPP1R160; TSC2
Calculated MW	201kDa
Observed MW	200kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	PC-3, 293T
Cellular location	Cytoplasm, Membrane, Peripheral membrane protein