Review (1)Publication (2) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | TWEAKR/Fn14/CD266 Rabbit mAb |
---|---|
Catalog No. | A5955 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2119 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAKR/Fn14/CD266 (Q9NP84). |
---|---|
Sequence | MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Gene ID | |
Swiss Prot | |
Synonyms | FN14; CD266; TWEAKR |
Calculated MW | 14kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HepG2, PC-3 |
Cellular location | Plasma membrane |
Customer validation | (Hela HepG2 PC-3 ES-2 EFE-184 PEO) WB(Mus musculus) IHC(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5955? Please let us know so that we can cite the reference in this datasheet.