Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | TriMethyl-Histone H3-K36 Rabbit mAb |
---|---|
Catalog No. | A20379 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50050 |
Immunogen | A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1). |
---|---|
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
Gene ID | |
Swiss Prot | |
Synonyms | H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36 |
Calculated MW | 15kDa |
Observed MW |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, NIH/3T3, C6 |
Cellular location | Chromosome, nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus, Saccharomyces cerevisiae) ChIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20379? Please let us know so that we can cite the reference in this datasheet.