제품 > 항체 > 메틸화 특이적 항체

TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and H3K36me3 Rabbit mAb (A20379). The ChIP sequencing results indicate the enrichment pattern of H3K36me3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.

ABclonal:Western blot - TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Western blot analysis of various lysates using TriMethyl-Histone H3-K36 Rabbit mAb (A20379) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Dot-blot analysis of all sorts of peptides using TriMethyl-Histone H3-K36 antibody (A20379) at 1:1000 dilution.

ABclonal:Immunohistochemistry - TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (A20379) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (A20379) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Immunoprecipitation analysis of 600 μg extracts of 293F cells using 5 μg TriMethyl-Histone H3-K36 antibody (A20379). Western blot was performed from the immunoprecipitate using TriMethyl-Histone H3-K36 antibody (A20379) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - TriMethyl-Histone H3-K36 Rabbit mAb (A20379)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (A20379) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	TriMethyl-Histone H3-K36 Rabbit mAb
Catalog No.	A20379
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC50050

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen	A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID
Swiss Prot
Synonyms	H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36
Calculated MW	15kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 DB 1:500 - 1:1000 IHC-P 1:100 - 1:500 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 5μg-10μg of Chromatin ChIP-seq 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, NIH/3T3, C6
Cellular location	Chromosome, nucleus.
Customer validation	WB(Homo sapiens, Mus musculus, Saccharomyces cerevisiae) ChIP(Homo sapiens)