Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using β-Tubulin Rabbit mAb (A12289) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from 293F cells, using β-Tubulin Rabbit mAb (A12289) at 1:1000-1:30000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using β-Tubulin Rabbit mAb (A12289) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of C6 cells using β-Tubulin Rabbit mAb (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using β-Tubulin Rabbit mAb (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using β-Tubulin Rabbit mAb (A12289) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | β-Tubulin Rabbit mAb |
|---|---|
| Catalog No. | A12289 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0203 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human β-Tubulin (P07437). |
|---|---|
| Sequence | LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56; β-Tubulin |
| Calculated MW | 50kDa |
| Observed MW | 55kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | 293F, SH-SY5Y, Mouse Brain, Mouse Thymus, Rat Brain |
| Cellular location | Cytoplasm, cytoskeleton. |
| Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Chlorocebus aethiops, Gallus gallus) IF(Danio rerio) IHC(Mus musculus) IP(Oryctolagus cuniculus) WB(Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12289? Please let us know so that we can cite the reference in this datasheet.
