Reviews (2)Publication (2) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Tyrosine Hydroxylase Rabbit mAb |
---|---|
Catalog No. | A5079 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1184 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Tyrosine Hydroxylase (P07101). |
---|---|
Sequence | MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLE |
Gene ID | |
Swiss Prot | |
Synonyms | TYH; DYT14; DYT5b; Tyrosine Hydroxylase |
Calculated MW | 59kDa |
Observed MW | 59kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y, Mouse brain, Rat brain |
Cellular location | axon, cytoplasm, cytoplasmic side of plasma membrane, cytoplasmic vesicle, cytosol, dendrite, mitochondrion, neuron projection, nucleus, perikaryon, perinuclear region of cytoplasm, smooth endoplasmic reticulum, synaptic vesicle, terminal bouton |
Customer validation | (Ischemia-reperfusion rat heart tissue, mouse ICA cells ) WB(Rattus norvegicus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5079? Please let us know so that we can cite the reference in this datasheet.