Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Tyrosine Hydroxylase Rabbit pAb |
---|---|
Catalog No. | A0028 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synTyrosine Hydroxylase etic peptide corresponding to a sequence wiTyrosine Hydroxylase in amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2). |
---|---|
Sequence | KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
Gene ID | |
Swiss Prot | |
Synonyms | TYH; DYT14; DYT5b; Tyrosine Hydroxylase |
Calculated MW | 59kDa |
Observed MW | 59kDa/58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Rat brain, Jurkat |
Cellular location | axon, cytoplasm, cytoplasmic side of plasma membrane, cytoplasmic vesicle, cytosol, dendrite, mitochondrion, neuron projection, nucleus, perikaryon, perinuclear region of cytoplasm, smooth endoplasmic reticulum, synaptic vesicle, terminal bouton. |
Customer validation | IF(Mus musculus, Homo sapiens) WB(Rattus norvegicus, Mus musculus) IHC(Rattus norvegicus, Mus musculus) IHC(Mus musculus) IF(Rattus norvegicus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0028? Please let us know so that we can cite the reference in this datasheet.